PTM Viewer PTM Viewer

AT1G22170.1

Arabidopsis thaliana [ath]

Phosphoglycerate mutase family protein

No PTMs currently found

PLAZA: AT1G22170
Gene Family: HOM05D002738
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 334

MATATSHQSVVSFASLRSSPSSTISQCGFKIDSSLSFTSKKTNFCKIKAMASSVSYDNTLLSPSKTIPDNSQKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTEKGVEEAIEAGKRISNIPVDVIFTSSLIRAQMTAMLAMIQHRRKKVPIILHDESEQAKTWSQVFSDETKNQSIPVIPAWQLNERMYGELQGLNKQETAERYGKEQVHEWRRSYDIPPPKGESLEMCAERAVAYFQDNIEPKLAAGKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIFKEGKFMKRGSPVGPTEAGVYAYTKRLAQYRQKLEDDSEVLCA

Domains & Sites

Clear highlighted range 
Molecule Processing
Show Type From To
Transit Peptide 1 48
Sites
Show Type Position
Metal Ion-binding Site 258
Site 85
Site 188
Active Site 84
Active Site 97
Active Site 134
Active Site 188
Active Site 199
Active Site 215
Active Site 259

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here